PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009779434.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 209aa    MW: 24103.6 Da    PI: 8.043
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009779434.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1872.9e-2744132290
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     fY++YAk+vGF +r+++ ++s+ +++i +r++ C+k+g+  + k++    r+tr++tr gCka++ vk +k++kw+vt++++eH+H+l 
  XP_009779434.1  44 FYDDYAKRVGFIMRIDQCRRSEVDKRILSRRLSCNKQGYYVKMKNHYGPPRKTRTSTREGCKAMMLVKVNKSDKWVVTRFVKEHTHPLI 132
                     9*******************************************999****************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.2E-2544132IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MNLETGAATI DCSAESQLVA CEDNVVREPF IGMEFESEDA AKGFYDDYAK RVGFIMRIDQ  60
CRRSEVDKRI LSRRLSCNKQ GYYVKMKNHY GPPRKTRTST REGCKAMMLV KVNKSDKWVV  120
TRFVKEHTHP LIASGCSSRN AMDKKDRRIL ELSAELEHQD KLCDLYREQL ITFLESVEQQ  180
MELLSKKIEV AVNNVKEIEA EVQKPSNNQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754481e-145HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779434.11e-156PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_009779435.11e-156PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLK4CTH71e-129K4CTH7_SOLLC; Uncharacterized protein
STRINGSolyc09g057880.2.11e-129(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA116022025
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.12e-67FAR1 family protein